PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G107400.1
Common NamePHAVU_003G107400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 183aa    MW: 21224.4 Da    PI: 9.1675
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G107400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.38.5e-232876149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        k+ie +sn+qvtfskRr+g++KKA+EL+ LC+a  a+i+fs+  kl+ +
  Phvul.003G107400.1 28 KKIEKSSNKQVTFSKRRTGLFKKASELCLLCNASMAIIVFSPAEKLFCF 76
                        68*******************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.0E-312079IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.4272080IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.81E-272191IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-202242IPR002100Transcription factor, MADS-box
PfamPF003191.3E-222976IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-204257IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-205778IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MDNHNFSSGI DAFKQQKKKG GRKKIEIKKI EKSSNKQVTF SKRRTGLFKK ASELCLLCNA  60
SMAIIVFSPA EKLFCFGHPD LEGIVESYLR GDKVFQPLES RERSVSYEEC NKQYEEATKK  120
LELEKKNLRE TDTLVNGFNR RWWEDPIDQM SETELEQFMV SVYELRRKLA ERGGELLKQA  180
ML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-1721113190Myocyte-specific enhancer factor 2A
3p57_I2e-1721113190Myocyte-specific enhancer factor 2A
3p57_D2e-1721113190Myocyte-specific enhancer factor 2A
3p57_C2e-1721113190Myocyte-specific enhancer factor 2A
3p57_B2e-1721113190Myocyte-specific enhancer factor 2A
3p57_A2e-1721113190Myocyte-specific enhancer factor 2A
3kov_J2e-1721113190Myocyte-specific enhancer factor 2A
3kov_I2e-1721113190Myocyte-specific enhancer factor 2A
3kov_B2e-1721113190Myocyte-specific enhancer factor 2A
3kov_A2e-1721113190Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154305.11e-133hypothetical protein PHAVU_003G107400g
TrEMBLV7C8481e-133V7C848_PHAVU; Uncharacterized protein
STRINGGLYMA17G01771.11e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-26AGAMOUS-like 62